PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033738
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 263aa    MW: 29594 Da    PI: 4.832
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033738genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ +++++G  +W+  ++  g++R++k+c++rw +yl
      Lus10033738 14 KGTWTAEEDRKLIAYITRYGCWNWRQLPKFAGLKRCGKSCRLRWMNYL 61
                     799*****************99************************97 PP

2Myb_DNA-binding45.22.1e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ + eE+e ++++ + lG++ W+ Ia +++ gR+++++k++w++
      Lus10033738  67 RGNYSLEEEETILRLRAALGNK-WSVIATHLP-GRSDNEIKNHWHS 110
                      8999******************.*********.***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.638961IPR017930Myb domain
SuperFamilySSF466894.67E-2811108IPR009057Homeodomain-like
SMARTSM007172.0E-101363IPR001005SANT/Myb domain
PfamPF002493.7E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-221568IPR009057Homeodomain-like
CDDcd001678.80E-91661No hitNo description
PROSITE profilePS5129421.59162116IPR017930Myb domain
SMARTSM007177.8E-1466114IPR001005SANT/Myb domain
PfamPF002494.4E-1367110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-2369115IPR009057Homeodomain-like
CDDcd001672.07E-869112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MVRTPSCDEN GMRKGTWTAE EDRKLIAYIT RYGCWNWRQL PKFAGLKRCG KSCRLRWMNY  60
LRPDLKRGNY SLEEEETILR LRAALGNKWS VIATHLPGRS DNEIKNHWHS SLKKRAVGKS  120
QSPASSSSTT QSSEYREVKE EGIDKPQMEI PDGVPVLESS ISWISTLPPP QSDATSSSSS  180
LSPSLFSFDS VATEAGSTAS GAGLSDVLSD LSSFVDLWET NEPYNNWPEP EPMVTTDNYW  240
YMPSEVYESL AVEEEPQFPL FY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095861.11e-71Myb-related protein Myb4
TrEMBLW9RAQ02e-71W9RAQ0_9R
STRINGGLYMA06G45547.12e-67(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28110.17e-57myb domain protein 41